NME3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84278-5-RR (same clone as 84278-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84278-5-RR (NME3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84278-5-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 84278-5-RR (same clone as 84278-5-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 84278-5-RR (NME3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84278-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 84278-5-RR (same clone as 84278-5-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 84278-5-RR (NME3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84278-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 84278-5-RR (same clone as 84278-5-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 84278-5-RR (NME3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84278-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 84278-5-RR (same clone as 84278-5-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using NME3 antibody (84278-5-RR, Clone: 241585H7 ) at dilution of 1:500 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 84278-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84278-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84278-5-RR against Human NME3 were performed. The affinity constant is below 1 pM.

NME3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84278-5-PBS

Clone No.241585H7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

241585H7, DR nm23, DR-nm23, EC:2.7.4.6, KIAA0516

---

Product Information

84278-5-PBS targets NME3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7284

  Product name: Recombinant human NME3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-169 aa of BC000250

  Sequence: ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE

• Full Name: non-metastatic cells 3, protein expressed in
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC000250
• Gene Symbol: NME3
• Gene ID (NCBI): 4832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13232
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NME3 (NME/NM23 Nucleoside Diphosphate Kinase 3), also named as NM23-H3; DR-NM23, is a member of the nucleoside diphosphate kinase (NDPK) family that binds to the mitochondrial outer membrane to stimulate mitochondrial fusion. The depletion of NME3 will cause dysfunction in mitochondrial dynamics. NME3 has been found to facilitate DNA-repair mechanisms binds to several NPHPs, including NEK8, CEP164, and ankyrin repeat and sterile α motif domain-containing 6 (ANKS6)