Product Information
25102-1-PBS targets NMES1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18744 Product name: Recombinant human C15orf48 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 3-83 aa of BC021173 Sequence: FFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQNVQRVTK Predict reactive species |
| Full Name | chromosome 15 open reading frame 48 |
| Calculated Molecular Weight | 83 aa, 9 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC021173 |
| Gene Symbol | C15orf48 |
| Gene ID (NCBI) | 84419 |
| RRID | AB_3669463 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9C002 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Nmes1, encoding for Normal Mucosa of Esophagus-Specific gene 1, also known as C15orf48, Modulator of Cytochrome C Oxidase during Inflammation [MOCCI]), was first identified in a study of human esophageal squamous cell carcinoma (ESCC) tissues (PMID: 30013631). Nmes1 is expressed in epithelial tissue and is believed to be a tumor suppressor gene. Nmes1 encodes for a small protein consisting of 83 amino acid and is a nuclear protein (PMID: 37971166).
