Noggin Polyclonal antibody

Noggin Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14772-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA, Cell treatment

NOG, Noggin, SYM1, SYNS1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells
Positive IHC detected inhuman gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14772-1-AP targets Noggin in WB, IHC, IF, IP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6586

Product name: Recombinant human NOG protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-232 aa of BC034027

Sequence: MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Predict reactive species
Full Name noggin
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC034027
Gene Symbol Noggin
Gene ID (NCBI) 9241
RRIDAB_2151671
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13253
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Noggin is an extracellular polypeptide acting as an antagonist of bone morphogenetic proteins (BMPs) regulating embryonal development. Noggin inhibits activity of BMP-2, -4, -7, -13, and -14.

What is the molecular weight of Noggin? Is Noggin post-translationally modified?

The molecular weight of Noggin is 26 kDa. Noggin is secreted as a covalently linked glycosylated homodimer (PMID: 12478285).

What is the subcellular localization of Noggin?

Noggin is present extracellularly in the matrix or retained at the cell surface via interaction with HSPG (PMID: 11706034).

What is the tissue expression pattern of Noggin?

In early development stages, Noggin is produced by the Spemann organizer, allowing dorsal-ventral patterning of BMPs (PMID: 8752214). Subsequently, Noggin is expressed by the notochord regulating BMP-4 signaling in neurogenesis. Additionally, Noggin is present during development in the dermal papilla, connective tissue of the hair follicle, lens, retina, and periocular mesenchyme, as well as in the mesoderm lineage regulating development of the bone, cartilage, and muscles (PMID: 21256973).

What is the use of Noggin in cell culture?

Noggin can be used for maintaining the pluripotency of human embryonic stem cells (PMID: 19500111).


Publications

SpeciesApplicationTitle
mouseWB

Cell Death Dis

PMID: 29415997

Authors - Shu-Fen Li
hamsterIHC

Birth Defects Res

Cigarette smoke induced neural tube defects by down-regulating noggin expression.

Authors - Chuanhui Yin
WB,IP,IF

Nat Commun

Brown adipose tissue secretes OLFM4 to coordinate sensory and sympathetic innervation via Schwann cells

Authors - Mingqiang Lai
mouse

Microbiome

Desulfovibrio vulgaris interacts with novel gut epithelial immune receptor LRRC19 and exacerbates colitis

Authors - Runxiang Xie
humanCell treatment

Life Med

Comparative functional RNA editomes of neural differentiation from human PSCs

Authors - Yu Zhang
Loading...
||
New chat

Able

正在加载,请稍候...