Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue, mouse placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
| Positive FC (Intra) detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30023-1-AP targets Noggin in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32755 Product name: Recombinant human NOG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 28-145 aa of BC034027 Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL Predict reactive species |
| Full Name | noggin |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 32 kDa, 64 kDa |
| GenBank Accession Number | BC034027 |
| Gene Symbol | Noggin |
| Gene ID (NCBI) | 9241 |
| RRID | AB_2935501 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13253 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Noggin is an extracellular polypeptide acting as an antagonist of bone morphogenetic proteins (BMPs) regulating embryonal development. Noggin inhibits activity of BMP-2, -4, -7, -13, and -14. Noggin is present extracellularly in the matrix or retained at the cell surface via interaction with heparin sulfate proteoglycans. In early development stages, Noggin is produced by the Spemann organizer, allowing dorsal-ventral patterning of BMPs (PMID: 8752214). Subsequently, Noggin is expressed by the notochord regulating BMP-4 signaling in neurogenesis. Additionally, Noggin is present during development in the dermal papilla, connective tissue of the hair follicle, lens, retina, and periocular mesenchyme, as well as in the mesoderm lineage regulating development of the bone, cartilage, and muscles.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Noggin antibody 30023-1-AP | Download protocol |
| IF protocol for Noggin antibody 30023-1-AP | Download protocol |
| IHC protocol for Noggin antibody 30023-1-AP | Download protocol |
| WB protocol for Noggin antibody 30023-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
J Nanobiotechnology Exosomes derived from mouse vibrissa dermal papilla cells promote hair follicle regeneration during wound healing by activating Wnt/β-catenin signaling pathway | ||
Discov Oncol A novel prognostic risk score associated with resistance to docetaxel chemotherapy for predicting biochemical recurrence-free survival in patients with prostate cancer.
|











