Noggin Polyclonal antibody

Noggin Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 30023-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

NOG, SYM1, SYNS1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue, mouse placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

30023-1-AP targets Noggin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32755

Product name: Recombinant human NOG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 28-145 aa of BC034027

Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL

Predict reactive species
Full Name noggin
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 32 kDa, 64 kDa
GenBank Accession NumberBC034027
Gene Symbol Noggin
Gene ID (NCBI) 9241
RRIDAB_2935501
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13253
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Noggin is an extracellular polypeptide acting as an antagonist of bone morphogenetic proteins (BMPs) regulating embryonal development. Noggin inhibits activity of BMP-2, -4, -7, -13, and -14. Noggin is present extracellularly in the matrix or retained at the cell surface via interaction with heparin sulfate proteoglycans. In early development stages, Noggin is produced by the Spemann organizer, allowing dorsal-ventral patterning of BMPs (PMID: 8752214). Subsequently, Noggin is expressed by the notochord regulating BMP-4 signaling in neurogenesis. Additionally, Noggin is present during development in the dermal papilla, connective tissue of the hair follicle, lens, retina, and periocular mesenchyme, as well as in the mesoderm lineage regulating development of the bone, cartilage, and muscles.

Protocols

Product Specific Protocols
FC protocol for Noggin antibody 30023-1-APDownload protocol
IHC protocol for Noggin antibody 30023-1-APDownload protocol
WB protocol for Noggin antibody 30023-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Nanobiotechnology

Exosomes derived from mouse vibrissa dermal papilla cells promote hair follicle regeneration during wound healing by activating Wnt/β-catenin signaling pathway

Authors - Yage Shang
Loading...
||
New chat Able
正在加载,请稍候...