NOL11 Recombinant monoclonal antibody

• 

  WB analysis using 83391-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83391-6-RR (NOL11 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 83391-6-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NOL11 antibody (83391-6-RR, Clone: 240371B5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 83391-6-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NOL11 antibody (83391-6-RR, Clone: 240371B5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of HeLa using 83391-6-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug NOL11 Recombinant antibody (83391-6-RR, Clone:240371B5) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• 

  Affinity and Kinetic Characterization of 83391-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83391-6-RR against Human NOL11 were performed. The affinity constant is below 1 pM.

NOL11 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 83391-6-RR

Clone No.240371B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

Nucleolar protein 11, L14, 240371B5

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, HT-29 cells, SW480 cells, A431 cells
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83391-6-RR targets NOL11 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11783

  Product name: Recombinant human NOL11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC064404

  Sequence: MAALEEEFTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVLRIWNNEDVNLDKVFKATLSAEVYRILSVQGTEPLVLFKEGAVRGLEALLADPQQKIETVISDEEVIKWTKFFVVFRHPVLIFITEKHGNYFAYVQMFNSRILTKYTLLLGQDENSVIKSFTASVDRKFISLMSLSSDGCIYETLIPIRPADPEKNQSLVKSLLLKAVVSGNARNGVALTALDQDHVAVLGSPLAASKECLSVWNIKFQTLQTSKELPQGTSGQLWYYGEHLFMLHGKSLTVIPYKCEVSSLAGALGKLKHSQDP

• Full Name: nucleolar protein 11
• Calculated Molecular Weight: 719 aa, 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC064404
• Gene Symbol: NOL11
• Gene ID (NCBI): 25926
• RRID: AB_3671045
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9H8H0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOL11, also named as L14, is a ribosome biogenesis factor. It is required for both optimal rDNA transcription and small subunit (SSU) pre-rRNA processing at sites A', A0, 1 and 2b. NOL11 forms a protein complex with two tryptophan-aspartic acid (WD) repeat proteins named WD-repeat protein 43 (WDR43) and Cirhin in mitotic cells. NOL11 plays a role in pathogenesis of NAIC. There're some isoforms with MW 81 kDa and 19 kDa.