CoraLite® Plus 488-conjugated NOL11 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-83391-6

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 NOL11 antibody (CL488-83391-6, Clone: 240371B5 ) at dilution of 1:200.

NOL11 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83391-6

Clone No.240371B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

Nucleolar protein 11, L14, 240371B5

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83391-6 targets NOL11 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11783

  Product name: Recombinant human NOL11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC064404

  Sequence: MAALEEEFTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVLRIWNNEDVNLDKVFKATLSAEVYRILSVQGTEPLVLFKEGAVRGLEALLADPQQKIETVISDEEVIKWTKFFVVFRHPVLIFITEKHGNYFAYVQMFNSRILTKYTLLLGQDENSVIKSFTASVDRKFISLMSLSSDGCIYETLIPIRPADPEKNQSLVKSLLLKAVVSGNARNGVALTALDQDHVAVLGSPLAASKECLSVWNIKFQTLQTSKELPQGTSGQLWYYGEHLFMLHGKSLTVIPYKCEVSSLAGALGKLKHSQDP

• Full Name: nucleolar protein 11
• Calculated Molecular Weight: 719 aa, 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC064404
• Gene Symbol: NOL11
• Gene ID (NCBI): 25926
• RRID: AB_3673246
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H8H0
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

NOL11, also named as L14, is a ribosome biogenesis factor. It is required for both optimal rDNA transcription and small subunit (SSU) pre-rRNA processing at sites A', A0, 1 and 2b. NOL11 forms a protein complex with two tryptophan-aspartic acid (WD) repeat proteins named WD-repeat protein 43 (WDR43) and Cirhin in mitotic cells. NOL11 plays a role in pathogenesis of NAIC. There're some isoforms with MW 81 kDa and 19 kDa.