NOL7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NOL7 Polyclonal antibody, PBS Only (18424-1-PBS)

• 

  WB analysis of HEK-293 using 18424-1-AP (same clone as 18424-1-PBS)

  WB result of NOL7 antibody (18424-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NOL7 transfected HEK-293 cells. This data was developed using the same antibody clone with 18424-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18424-1-AP (same clone as 18424-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18424-1-AP (NOL7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18424-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 18424-1-AP (same clone as 18424-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using NOL7 antibody (18424-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 18424-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NOL7 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 18424-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

C6orf90, NOP27, Nucleolar protein 7, nucleolar protein 7, 27kDa, Nucleolar protein of 27 kDa

---

Product Information

18424-1-PBS targets NOL7 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13272

  Product name: Recombinant human NOL7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-257 aa of BC023517

  Sequence: MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFKRRWMVRKMKTKK

• Full Name: nucleolar protein 7, 27kDa
• Calculated Molecular Weight: 257 aa, 29 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC023517
• Gene Symbol: NOL7
• Gene ID (NCBI): 51406
• RRID: AB_3741952
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UMY1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NOL7 (nucleolar protein 7) is localized in both the nucleolus and nucleoplasm, with its nucleolar localization being RNA-dependent. Its function in the nucleolus is likely related to maintaining nucleolar structure and cell growth, while its role in the nucleoplasm may be associated with anti-angiogenic effects. Additionally, NOL7 is involved in the accumulation of early pre-rRNA and the processing of pre-18S rRNA, which are crucial for maintaining nucleolar function and cell growth. The expression of NOL7 is regulated by various transcription factors, including c-myc and RXRα. In cervical cancer, NOL7 transcription is also positively regulated by the RB tumor suppressor gene. The NOL7 gene encodes three distinct splice variants, each with different intracellular localizations that may affect their functions.