NOMO2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NOMO2 Polyclonal antibody, PBS Only (14328-1-PBS)

• 

  WB analysis of BxPC-3 using 14328-1-AP (same clone as 14328-1-PBS)

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 14328-1-AP (NOMO2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14328-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14328-1-AP (same clone as 14328-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14328-1-AP (NOMO2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14328-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 14328-1-AP (same clone as 14328-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14328-1-AP (NOMO2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14328-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 14328-1-AP (same clone as 14328-1-PBS)

  IP result of anti-NOMO2 (IP:14328-1-AP, 4ug; Detection:14328-1-AP 1:1000) with HEK-293 cells lysate 2400ug. This data was developed using the same antibody clone with 14328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14328-1-AP (same clone as 14328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14328-1-AP (NOMO2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14328-1-AP (same clone as 14328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14328-1-AP (NOMO2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14328-1-PBS in a different storage buffer formulation.

• 

  IF Staining of BxPC-3 using 14328-1-AP (same clone as 14328-1-PBS)

  Immunofluorescent analysis of BxPC-3 cells using 14328-1-AP (NOMO2 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14328-1-PBS in a different storage buffer formulation.

NOMO2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14328-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

BOS complex subunit NOMO2, Nodal modulator 2, pM5 protein 2

---

Product Information

14328-1-PBS targets NOMO2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5595

  Product name: Recombinant human NOMO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 873-1222 aa of BC041131

  Sequence: YALAGVSFEIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKHITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVGALGQAASDNSGPEDAKRQAKKQKTRRT

• Full Name: NODAL modulator 2
• Calculated Molecular Weight: 139 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC041131
• Gene Symbol: NOMO2
• Gene ID (NCBI): 283820
• RRID: AB_2152154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JPE7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.