nNOS Polyclonal antibody

• 

  WB analysis using 29231-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29231-1-AP (nNOS antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 29231-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29231-1-AP (nNOS antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 29231-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29231-1-AP (nNOS antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 29231-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using nNOS antibody (29231-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of rat brain using 29231-1-AP

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded rat brain tissue using nNOS antibody (29231-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of HeLa using 29231-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human nNOS (29231-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

nNOS Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA

Cat No. 29231-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA

Synonyms

NOS1, bNOS, EC:1.14.13.39, N NOS, NC NOS

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue
• Positive IF-Fro detected in: rat brain tissue
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 2 publications below

Product Information

29231-1-AP targets nNOS in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28910

  Product name: Recombinant human NOS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-262 aa of NM_000620

  Sequence: VRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAPRPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQVDRDLDGKSHKPLPLGVENDRVF

• Full Name: nitric oxide synthase 1 (neuronal)
• Calculated Molecular Weight: 161 kDa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: NM_000620
• Gene Symbol: nNOS
• Gene ID (NCBI): 4842
• RRID: AB_2918255
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29475
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

nNOS belongs to the NOS family. nNOS produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. NO is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. NO is synthesized from L-arginine by nitric oxide synthases. nNOS is a nitric oxide synthase which is highly expressed in skeletal muscle. Genetic variations in nNOS gene are associated with susceptibility to infantile hypertrophic pyloric stenosis type 1 (IHPS1).The antibody can recognize isoform 1,2,4 of nNOS.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Neurosci Lett; Effects of ligustrazine on energy metabolism in migraine rats based on mitochondria-inflammation pathway; Authors - Yicheng Wang
human	WB	J Cell Mol Med; S-Nitrosylation of NOTCH1 Regulates Mesenchymal Stem Cells Differentiation Into Hepatocyte-Like Cells by Inhibiting Notch Signalling Pathway; Authors - Xuesong Wang
rat	WB	Fluids Barriers CNS; Rh-relaxin-2 attenuates oxidative stress and neuronal apoptosis via ERK-nNOS-NO pathway after germinal matrix hemorrhage in rats; Authors - Jun Liu
rat	IF	Life Sci; An animal model induced by bilateral cavernous nerve crushing mimics post-radical prostatectomy erectile dysfunction in old rats; Authors - Yunlong Ge
rat	IF	J Nanobiotechnology; Biodegradable nano black phosphorus based SDF1-α delivery system ameliorates Erectile Dysfunction in a cavernous nerve injury rat model by recruiting endogenous stem/progenitor cells; Authors - Qingfeng Fu
rat	WB	Pain Res Manag; Exploring the Analgesic Initiation Mechanism of Tuina in the Dorsal Root Ganglion of Minor CCI Rats via the TRPV1/TRPA1-cGMP Pathway; Authors - Zhenjie Yang