Tested Applications
| Positive WB detected in | U-87 MG cells, HEK-293T cells |
| Positive IP detected in | HEK-293 cells, U-87 MG cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28580-1-AP targets NOTCH2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29413 Product name: Recombinant human NOTCH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1697-1819 aa of NM_024408 Sequence: VIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVL Predict reactive species |
| Full Name | Notch homolog 2 (Drosophila) |
| Calculated Molecular Weight | 265 kDa |
| Observed Molecular Weight | 110 kDa, 265 kDa |
| GenBank Accession Number | NM_024408 |
| Gene Symbol | NOTCH2 |
| Gene ID (NCBI) | 4853 |
| RRID | AB_2881175 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q04721 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NOTCH2 (Neurogenic locus notch homolog protein 2) belongs to the NOTCH family.. In kidney, previous reports demonstrated that Notch1 and Notch2 were activated in mammalian nephrogenesis (PMID: 24526233). Notch2 is expressed in many cell types of most lineages in the hematolymphoid compartment and has specific roles in differentiation and function of various immune cells. Notch2 is required for development of splenic marginal zone B cells and regulates differentiation of dendritic cells (DCs) in the spleen. Notch2 appears to play some specific roles in the intestinal immunity, given that the fate of mast cells and a subset of DCs is regulated by Notch2 in the intestine. Notch2 also has important roles in helper T cell divergence from naïve CD4 T cells and activation of cytotoxic T cells (PMID: 22695918).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NOTCH2 antibody 28580-1-AP | Download protocol |
| IHC protocol for NOTCH2 antibody 28580-1-AP | Download protocol |
| IP protocol for NOTCH2 antibody 28580-1-AP | Download protocol |
| WB protocol for NOTCH2 antibody 28580-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Notch2 (Cat# 28580-1-AP) has 17 total citations, published in journals including Cell Reports in Medicine, Cancer Letters, Frontiers in Immunology, Journal of Investigative Dermatology, Life Sciences, European Journal of Pharmacology, International Journal of Molecular Sciences, Journal of Cellular and Molecular Medicine, and Cell Signaling. Research fields span oncology (colorectal, bladder, breast, lung, renal, prostate cancers), Notch signaling pathway regulation, epidermal differentiation, vascular biology, fracture healing, and neural stem cell biology.
| Species | Application | Title |
|---|---|---|
Cell Rep Med Combined therapy with DR5-targeting antibody-drug conjugate and CDK inhibitors as a strategy for advanced colorectal cancer | ||
Cancer Lett Therapeutic targeting m6A-guided miR-146a-5p signaling contributes to the melittin-induced selective suppression of bladder cancer. | ||
Cancer Lett YTHDF3 Drives Tumor Growth and Metastasis by Recruiting eIF4B to Promote Notch2 Translation in Breast Cancer | ||
J Invest Dermatol ASH2L mediates epidermal differentiation and hair follicle morphogenesis via H3K4me3 modification | ||
Front Immunol Identification of SCAMP2 as a regulator of NOTCH signaling in cisplatin resistance through a novel prognostic model for bladder cancer | ||
Drug Deliv Transl Res LINC00460 promotes neuroblastoma tumorigenesis and cisplatin resistance by targeting miR-149-5p/DLL1 axis and activating Notch pathway in vitro and in vivo |
