NOTCH2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NOTCH2 Polyclonal antibody, PBS Only (28580-1-PBS)

• 

  WB analysis using 28580-1-AP (same clone as 28580-1-PBS)

  U-87 MG cells were subjected to SDS PAGE followed by western blot with 28580-1-AP (NOTCH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28580-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293T using 28580-1-AP (same clone as 28580-1-PBS)

  WB result of NOTCH2 antibody (28580-1-AP; 1:4000; room temperature for 1.5 hours) with wild-type and NOTCH2 knockout HEK-293T cells. This data was developed using the same antibody clone with 28580-1-PBS in a different storage buffer formulation.

• 

  IP experiment of U-87 MG using 28580-1-AP (same clone as 28580-1-PBS)

  IP result of anti-NOTCH2 (IP:28580-1-AP, 4ug; Detection:28580-1-AP 1:5000) with U-87 MG cells lysate 1960 ug. This data was developed using the same antibody clone with 28580-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 28580-1-AP (same clone as 28580-1-PBS)

  IP result of anti-NOTCH2 (IP:28580-1-AP, 4ug; Detection:28580-1-AP 1:5000) with HEK-293 cells lysate 1575 ug. This data was developed using the same antibody clone with 28580-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 28580-1-AP (same clone as 28580-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 28580-1-AP (NOTCH2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28580-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 28580-1-AP (same clone as 28580-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using NOTCH2 antibody (28580-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 28580-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NOTCH2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 28580-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Notch homolog 2 (Drosophila), Notch 2, N2ICD, N2ECD, hN2

---

Product Information

28580-1-PBS targets NOTCH2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29413

  Product name: Recombinant human NOTCH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1697-1819 aa of NM_024408

  Sequence: VIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVL

• Full Name: Notch homolog 2 (Drosophila)
• Calculated Molecular Weight: 265 kDa
• Observed Molecular Weight: 110 kDa, 265 kDa
• GenBank Accession Number: NM_024408
• Gene Symbol: NOTCH2
• Gene ID (NCBI): 4853
• RRID: AB_2881175
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q04721
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NOTCH2 (Neurogenic locus notch homolog protein 2) belongs to the NOTCH family.. In kidney, previous reports demonstrated that Notch1 and Notch2 were activated in mammalian nephrogenesis (PMID: 24526233). Notch2 is expressed in many cell types of most lineages in the hematolymphoid compartment and has specific roles in differentiation and function of various immune cells. Notch2 is required for development of splenic marginal zone B cells and regulates differentiation of dendritic cells (DCs) in the spleen. Notch2 appears to play some specific roles in the intestinal immunity, given that the fate of mast cells and a subset of DCs is regulated by Notch2 in the intestine. Notch2 also has important roles in helper T cell divergence from naïve CD4 T cells and activation of cytotoxic T cells (PMID: 22695918).