NOTCH3 Polyclonal antibody

NOTCH3 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 30540-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

CADASIL, CASIL, Notch 3, Notch homolog 3 (Drosophila)

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, HeLa cells, U2OS cells, mouse lung tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30540-1-AP targets NOTCH3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30242

Product name: Recombinant human NOTCH3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2203-2321 aa of NM_000435

Sequence: SPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAMATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA

Predict reactive species
Full Name Notch homolog 3 (Drosophila)
Calculated Molecular Weight 244 kDa
Observed Molecular Weight 270 kDa, 90 kDa
GenBank Accession NumberNM_000435
Gene Symbol NOTCH3
Gene ID (NCBI) 4854
RRIDAB_3086356
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UM47
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOTCH3 (Neurogenic locus notch homolog protein 3) is one of four mammalian Notch proteins, which act as signalling receptors to control cell fate in many developmental and adult tissue contexts (PMID: 32210034). Notch is a transmembrane, developmental signalling receptor, which plays many crucial roles in developmental patterning, cell fate decisions, regulation of cell survival and proliferation (PMID:30246579). Genetic studies have shown that Notch3 gene knockouts are viable and have limited developmental defects, focussed mostly on defects in the arterial smooth muscle cell lineage. Notch3, in collaboration with other Notch proteins, is involved in stem cell regulation in different tissues in stem cell regulation in different tissues, and it also controls the plasticity of the vascular smooth muscle phenotype involved in arterial vessel remodelling. Overexpression, gene amplification and mis-activation of Notch3 are associated with different cancers, in particular triple negative breast cancer and ovarian cancer (PMID: 32210034).

Protocols

Product Specific Protocols
IHC protocol for NOTCH3 antibody 30540-1-APDownload protocol
IP protocol for NOTCH3 antibody 30540-1-APDownload protocol
WB protocol for NOTCH3 antibody 30540-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...