NOX2 Recombinant monoclonal antibody, PBS Only

NOX2 Uni-rAb® Recombinant Antibody for IF-P, FC (Intra), Indirect ELISA
Cat No. 82872-1-PBS
Clone No.1B17

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra), Indirect ELISA

CYBB, 1B17, CGD, CGD91-phox, Cytochrome b-245 heavy chain

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82872-1-PBS targets NOX2 in IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4402

Product name: Recombinant human CYBB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 418-570 aa of BC032720

Sequence: SILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

Predict reactive species
Full Name cytochrome b-245, beta polypeptide
Calculated Molecular Weight 577 aa, 65 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC032720
Gene Symbol NOX2
Gene ID (NCBI) 1536
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04839
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NOX2, also named as CYBB, CGD, 91-phox, gp91-1, gp91-phox, p22 phagocyte B-cytochrome, cytochrome b-245 and beta polypeptide, is a critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. This full length protein has three glycosylation sites. CYBB is found in human cardiomyocytes as multiple bands:the signal between 55 and 65 kDa is probably the unglycosylated protein, because the predicted molecular weight of unglycosylated CYBB protein is approximately 58 kDa(PMID: 17587483) to 65 kDa in phagocytes and the bands around 80 kDa probably represent glycosylated CYBB, as has also been shown in human umbilical vein endothelial cells(PMID:12610097). In other reports, it also can be detected a band of 91 kDa(PMID:19965781).

Loading...
||
New chat Able
正在加载,请稍候...