NOX2 Recombinant monoclonal antibody

NOX2 Uni-rAb® Recombinant Antibody for IF-P, FC (Intra), ELISA
Cat No. 82872-1-RR
Clone No.1B17

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, FC (Intra), ELISA

CYBB, 1B17, CGD, CGD91-phox, Cytochrome b-245 heavy chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse spleen tissue
Positive FC (Intra) detected inRAW 264.7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

82872-1-RR targets NOX2 in WB, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4402

Product name: Recombinant human CYBB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 418-570 aa of BC032720

Sequence: SILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

Predict reactive species
Full Name cytochrome b-245, beta polypeptide
Calculated Molecular Weight 577 aa, 65 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC032720
Gene Symbol NOX2
Gene ID (NCBI) 1536
RRIDAB_3670592
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04839
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOX2, also named as CYBB, CGD, 91-phox, gp91-1, gp91-phox, p22 phagocyte B-cytochrome, cytochrome b-245 and beta polypeptide, is a critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. This full length protein has three glycosylation sites. CYBB is found in human cardiomyocytes as multiple bands:the signal between 55 and 65 kDa is probably the unglycosylated protein, because the predicted molecular weight of unglycosylated CYBB protein is approximately 58 kDa(PMID: 17587483) to 65 kDa in phagocytes and the bands around 80 kDa probably represent glycosylated CYBB, as has also been shown in human umbilical vein endothelial cells(PMID:12610097). In other reports, it also can be detected a band of 91 kDa(PMID:19965781).

Protocols

Product Specific Protocols
IF protocol for NOX2 antibody 82872-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Clin Transl Med

Sodium pump subunit NKAα1 protects against diabetic endothelial dysfunction by inhibiting ferroptosis through the autophagy-lysosome degradation of ACSL4

Authors - Xue-Xue Zhu
Loading...
||
New chat Able
正在加载,请稍候...