CoraLite®555-conjugated NOX4 Monoclonal antibody

NOX4 Monoclonal Antibody for
Cat No. CL555-67681
Clone No.4E5F1

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

KOX, Kidney superoxide-producing NADPH oxidase, Kidney oxidase-1, Kidney oxidase 1, EC:1.6.3.1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®555
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL555-67681 targets NOX4 in applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6176

Product name: Recombinant human NOX4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 224-578 aa of BC040105

Sequence: PGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS

Predict reactive species
Full Name NADPH oxidase 4
Calculated Molecular Weight 67 kDa
Observed Molecular Weight67 kDa
GenBank Accession NumberBC040105
Gene Symbol NOX4
Gene ID (NCBI) 50507
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NPH5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NOX4 (NADPH oxidase 4) is a phagocyte-type oxidase, similar to that responsible for the production of large amounts of reactive oxygen species (ROS) in neutrophil granulocytes with resultant antimicrobial activity and it has been postulated to function in the kidney as an oxygen sensor that regulates the synthesis of erythropoietin in the renal cortex. Studies have reported molecular masses of Nox4 protein by western blot analysis ranging from 55 to 80 kDa. The truncated NOX4 splice variant D (28 kDa) lacks the majority of the transmembrane domain and has been shown to produce higher levels of ROS and DNA damage compared to its prototype. NOX4D has previously been shown to localise to the nucleus and nucleolus in various cell types and is implicated in the generation of reactive oxygen species (ROS) and DNA damage (PMID: 11728818, PMID: 29285262, PMID: 14670934). Nox4 in cardiac myocytes is primarily expressed in mitochondria, and upregulation of Nox4 induced by hypertrophic stimuli elicits mitochondrial dysfunction and cardiac failure. In breast or ovarian tumor cells, mitochondrial Nox4 contributes to oncogenesis. In vascular endothelial cells, however, Nox4 is expressed in the endoplasmic reticulum (ER) and plays a specific role in redox-mediated ER signaling (PMID: 24259511).

Loading...
||
New chat Able
正在加载,请稍候...