NPC1L1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NPC1L1 Polyclonal antibody, PBS Only (28085-1-PBS)

• 

  WB analysis using 28085-1-AP (same clone as 28085-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28085-1-AP (NPC1L1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28085-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 28085-1-AP (same clone as 28085-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 28085-1-AP (NPC1L1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28085-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 28085-1-AP (same clone as 28085-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 28085-1-AP (NPC1L1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28085-1-PBS in a different storage buffer formulation.

NPC1L1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28085-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28085-1-PBS targets NPC1L1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26277

  Product name: Recombinant human NPC1L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 415-514 aa of NM_001101648

  Sequence: MPNRSSYRYDSLLLGPKNFSGILDLDLLLELLELQERLRHLQVWSPEAQRNISLQDICYAPLNPDNTSLYDCCINSLLQYFQNNRTLLLLTANQTLMGQTS

• Full Name: NPC1 (Niemann-Pick disease, type C1, gene)-like 1
• Calculated Molecular Weight: 149 kDa
• Observed Molecular Weight: 140-149 kDa
• GenBank Accession Number: NM_001101648
• Gene Symbol: NPC1L1
• Gene ID (NCBI): 29881
• RRID: AB_2918146
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHC9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NPC1 like intracellular cholesterol transporter 1 (NPC1L1) is a multi-pass membrane protein which has 1332 amino acids and containing a conserved N-terminal Niemann-Pick C1 (NPC1) domain and a putative sterol-sensing domain (SSD). It is only found in the tubular membranes of primate hepatocytes and the brush-border membranes of the small intestine of mammals. PC1L1 is a key protein for intestinal absorption of cholesterol and plays an important role in cholesterol balance. Cholesterol contributes to cell proliferation, invasion and latency, and is essential for tumor formation and growth, so NPC1L1 plays a critical role in tumor development and spread (PMID: 36034854).