NPL Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85608-3-RR (same clone as 85608-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85608-3-RR (NPL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85608-3-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 85608-3-RR (same clone as 85608-3-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 85608-3-RR (NPL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85608-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85608-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85608-3-RR against Human NPL were performed. The affinity constant is 4.26 nM.

NPL Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85608-3-PBS

Clone No.243037E2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

c112, C1orf13, EC:4.1.3.3, N acetylneuraminate lyase, N-acetylneuraminate lyase

---

Product Information

85608-3-PBS targets NPL in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10137

  Product name: Recombinant human NPL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC058003

  Sequence: MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQ

• Full Name: N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase)
• Calculated Molecular Weight: 27 kDa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC058003
• Gene Symbol: NPL
• Gene ID (NCBI): 80896
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BXD5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The N-acetylneuraminate lyase(NPL) from human (hNAL) which consists of 320 amino acids, has a molecular mass of 35.2 kDa and it catalyses the reversible aldol reaction of sialic acid, and has been extensively used in the synthesis of sialic acids and its analogues(PMID:19057931). The enzyme is widely distributed and are present in numerous pro- and eukaryotic cells, in which they are localized only in the cytosol(PMID:12453637). It belongs to the DHDPS family and has 5 isoforms produced by alternative splicing.