NPL Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• NPL Recombinant monoclonal antibody (85608-3-RR)

• 

  WB analysis using 85608-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85608-3-RR (NPL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 85608-3-RR

  rat brain tissue were subjected to SDS PAGE followed by western blot with 85608-3-RR (NPL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 85608-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85608-3-RR against Human NPL were performed. The affinity constant is 4.26 nM.

NPL Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85608-3-RR

Clone No.243037E2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

c112, C1orf13, EC:4.1.3.3, N acetylneuraminate lyase, N-acetylneuraminate lyase

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat brain tissue, rat kidney tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85608-3-RR targets NPL in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10137

  Product name: Recombinant human NPL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC058003

  Sequence: MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQ

• Full Name: N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase)
• Calculated Molecular Weight: 27 kDa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC058003
• Gene Symbol: NPL
• Gene ID (NCBI): 80896
• RRID: AB_3744236
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BXD5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The N-acetylneuraminate lyase(NPL) from human (hNAL) which consists of 320 amino acids, has a molecular mass of 35.2 kDa and it catalyses the reversible aldol reaction of sialic acid, and has been extensively used in the synthesis of sialic acids and its analogues(PMID:19057931). The enzyme is widely distributed and are present in numerous pro- and eukaryotic cells, in which they are localized only in the cytosol(PMID:12453637). It belongs to the DHDPS family and has 5 isoforms produced by alternative splicing.