NPLOC4 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• NPLOC4 Recombinant monoclonal antibody (87535-4-RR)

• 

  WB analysis using 87535-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87535-4-RR (NPLOC4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87535-4-RR

  Biolayer interferometry (BLl) kinetic assays of 87535-4-RR against Human NPLOC4 were performed. The affinity constant is below 1 pM.

NPLOC4 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87535-4-RR

Clone No.252885C10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

NPL4, Protein NPL4

---

Tested Applications

• Positive WB detected in: 5637 cells, Caco-2 cells, PANC-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87535-4-RR targets NPLOC4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2219

  Product name: Recombinant human NPLOC4 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 261-608 aa of BC025930

  Sequence: DIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNMCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELAQTWKRSEQWATIEQLCSTVGGQLPGLHEYGAVGGSTHTATAAMWACQHCTFMNQPGTGHCEMCSLPRT

• Full Name: nuclear protein localization 4 homolog (S. cerevisiae)
• Calculated Molecular Weight: 608 aa, 68 kDa
• Observed Molecular Weight: 68-75 kDa
• GenBank Accession Number: BC025930
• Gene Symbol: NPLOC4
• Gene ID (NCBI): 55666
• RRID: AB_3745606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TAT6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NPLOC4 (NPL4 ubiquitin recognition factor) is an essential protein involved in numerous cellular processes, especially those related to the endoplasmic reticulum (ER) . It acts as a co-factor in the p97/VCP complex, which is vital for protein quality control and degradation via the ubiquitin-proteasome system. NPLOC4 plays a significant role in ER-associated degradation (ERAD), maintaining cellular homeostasis.