NPPC Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NPPC Polyclonal antibody (29352-1-AP)

• 

  IHC staining of rat heart using 29352-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 29352-1-AP (NPPC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat heart using 29352-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 29352-1-AP (NPPC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 29352-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using NPPC antibody (29352-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NPPC Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 29352-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, ELISA

Synonyms

C type natriuretic peptide, CNP, CNP2

---

Tested Applications

• Positive IHC detected in: rat heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29352-1-AP targets NPPC in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29609

  Product name: Recombinant human NPPC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 74-126 aa of NM_024409

  Sequence: DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

• Full Name: natriuretic peptide precursor C
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: NM_024409
• Gene Symbol: NPPC
• Gene ID (NCBI): 4880
• RRID: AB_3742310
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23582
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NPPC (C-type natriuretic peptide) is also named as CNP2, and belongs to the natriuretic peptide family. More recent studies have shown that in growing and preovulatory follicles, granulosa cells secrete into the follicular fluid, a C-type natriuretic peptide (NPPC, also known as CNP) capable of binding to cumulus cells membrane natriuretic peptide receptor 2 (NPR2, also known as guanylate cyclase B). The CNP/NPR2 complex, acting actively as guanylate cyclase, increases the concentration of cGMP both in cumulus cells and, indirectly, in the oocyte, maintaining meiosis arrest. The cAMP level is maintained due to the upstream activity type C natriuretic peptide (CNP, NPPC), produced by the granulosa cells, which is responsible for the production of cyclic guanosine monophosphate (cGMP) after binding to a specific NPR2 receptor (PMID: 35209923, PMID: 25183874, PMID: 20947764).