Home
Products
Primary Antibodies
NPS Polyclonal antibody, PBS Only (23609-1-PBS)

Filter: AllIHC

IHC staining of human pancreas cancer using 23609-1-AP (same clone as 23609-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 23609-1-AP (NPS antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23609-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 23609-1-AP (same clone as 23609-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 23609-1-AP (NPS antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23609-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 23609-1-AP (same clone as 23609-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain slide using 23609-1-AP (NPS Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23609-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 23609-1-AP (same clone as 23609-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain slide using 23609-1-AP (NPS Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23609-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas using 23609-1-AP (same clone as 23609-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas slide using 23609-1-AP (NPS Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23609-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas using 23609-1-AP (same clone as 23609-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas slide using 23609-1-AP (NPS Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23609-1-PBS in a different storage buffer formulation.

NPS Polyclonal antibody, PBS Only

Name: NPS Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 23609-1-PBS

NPS Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 23609-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

23609-1-PBS targets NPS in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag20322 Product name: Recombinant human NPS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-89 aa of BC156665 Sequence: YPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS Predict reactive species
Full Name	neuropeptide S
Calculated Molecular Weight	89 aa, 10 kDa
GenBank Accession Number	BC156665
Gene Symbol	NPS
Gene ID (NCBI)	594857
RRID	AB_2879303
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen Affinity purified
UNIPROT ID	P0C0P6
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.