Product Information
23609-1-PBS targets NPS in IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20322 Product name: Recombinant human NPS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-89 aa of BC156665 Sequence: YPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS Predict reactive species |
| Full Name | neuropeptide S |
| Calculated Molecular Weight | 89 aa, 10 kDa |
| GenBank Accession Number | BC156665 |
| Gene Symbol | NPS |
| Gene ID (NCBI) | 594857 |
| RRID | AB_2879303 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P0C0P6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |











