NR2F6 Monoclonal antibody

• 

  WB analysis of MCF-7 using 60117-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 60117-1-Ig (NR2F6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 60117-1-Ig

  MCF7 cells were subjected to SDS PAGE followed by western blot with 60117-1-Ig (NR2F6 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 60117-1-Ig

  MCF7 cells were subjected to SDS PAGE followed by western blot with 60117-1-Ig (NR2F6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 60117-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney using 60117-1-Ig(NR2F6 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 60117-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney using 60117-1-Ig(NR2F6 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 60117-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney using 60117-1-Ig(NR2F6 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 60117-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney using 60117-1-Ig(NR2F6 antibody) at dilution of 1:50 (under 10x lens).

• Featured Product
• KD/KO Validated

NR2F6 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60117-1-Ig

Clone No.2H2D11

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

EAR 2, EAR2, ERBAL2, NR2F6, V erbA related protein 2

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 2 publications below

Product Information

60117-1-Ig targets NR2F6 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7614

  Product name: Recombinant human NR2F6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-404 aa of BC002669

  Sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ

• Full Name: nuclear receptor subfamily 2, group F, member 6
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC002669
• Gene Symbol: NR2F6
• Gene ID (NCBI): 2063
• RRID: AB_2155654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10588
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NR2F6 belongs to NR2F subfamily members, which have their roles in the regulation of neurogenesis, organogenesis, and cellular differentiation during embryonic development [PMID:15875024]. NR2F6 acts as transcription factor by binding to a TGACCT direct-repeat motif and has been established in controlling facets of central nervous system (CNS) [12690040]. It is a nuclear attenuator that directly interferes with DNA binding of NF-AT and, subsequently, transcriptional activity of the NF-AT-dependent IL-17 expression. Otherwise, NR2F6 negatively interfered with transcriptional cytokine responses and acted as a barrier against autoimmunity [PMID:18701084].

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; Melanoma-intrinsic NR2F6 activity regulates antitumor immunity; Authors - Hyungsoo Kim
human	WB,IHC	Int J Mol Sci; NR2F6 Expression Correlates with Pelvic Lymph Node Metastasis and Poor Prognosis in Early-Stage Cervical Cancer.; Authors - Chunhao Niu
human	IHC	Int J Cancer; PMID: 30895619; Authors - Han Li ; KD Validated