NR2F6 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 60117-2-Ig (same clone as 60117-2-PBS)

  WB result of NR2F6 antibody (60117-2-Ig, 1:1000) with si-Control and si-NR2F6 transfected HeLa cells. This data was developed using the same antibody clone with 60117-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 60117-2-Ig (same clone as 60117-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60117-2-Ig (NR2F6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60117-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60117-2-Ig (same clone as 60117-2-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 60117-2-Ig (NR2F6 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60117-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 60117-2-Ig (same clone as 60117-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60117-2-Ig (NR2F6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60117-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 60117-2-Ig (same clone as 60117-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 60117-2-Ig(NR2F6 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60117-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 60117-2-Ig (same clone as 60117-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 60117-2-Ig(NR2F6 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60117-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 60117-2-Ig (same clone as 60117-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60117-2-Ig (NR2F6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60117-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NR2F6 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 60117-2-PBS

Clone No.2H2B8

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

2H2B8, EAR 2, EAR2, EAR-2, ERBAL2

---

Product Information

60117-2-PBS targets NR2F6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7614

  Product name: Recombinant human NR2F6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-404 aa of BC002669

  Sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ

• Full Name: nuclear receptor subfamily 2, group F, member 6
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC002669
• Gene Symbol: NR2F6
• Gene ID (NCBI): 2063
• RRID: AB_2155653
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10588
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NR2F6 belongs to NR2F subfamily members, which have their roles in the regulation of neurogenesis, organogenesis, and cellular differentiation during embryonic development (PMID:15875024). NR2F6 acts as transcription factor by binding to a TGACCT direct-repeat motif and has been established in controlling facets of central nervous system (CNS) (PMID: 12690040). It is a nuclear attenuator that directly interferes with DNA binding of NF-AT and, subsequently, transcriptional activity of the NF-AT-dependent IL-17 expression. Otherwise, NR2F6 negatively interfered with transcriptional cytokine responses and acted as a barrier against autoimmunity (PMID:18701084).