Product Information
25977-1-PBS targets NRAP in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23254 Product name: Recombinant human NRAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1309-1393 aa of BC126407 Sequence: RHDFVKERGKLIGPQSVRDDPRIQHCRRMGQLQSELQYRRGATSSQAQFHLPMDMVHLVHAKNAQALASDHDYRTQYHKFTALPE Predict reactive species |
| Full Name | nebulin-related anchoring protein |
| Observed Molecular Weight | 190-200 kDa |
| GenBank Accession Number | BC126407 |
| Gene Symbol | NRAP |
| Gene ID (NCBI) | 4892 |
| RRID | AB_2918098 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86VF7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
NRAP (Nebulin-related-anchoring protein) is a striated muscle-specific protein that is concentrated at intercalated disks in cardiac muscle and at myotendinous junctions in skeletal muscle. NRAP is a 197 kDa multidomain scaffolding protein from nebulin family with many interation partners such as α-actinin, actin, vinculin and filamin (PMID:21276443). During cardiomyocyte development in the foetal heart, NRAP is involved in myofibrillar assembly and links terminal actin filaments to membrane complexes in the adult heart. Several studies observed that NRAP mutation would contributed to the dilated cardiomyopathy which is a highly heterogeneous disease with almost 100 candidates genes to date (PMID:28611399).







