NRAP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NRAP Polyclonal antibody, PBS Only (25977-1-PBS)

• 

  WB analysis using 25977-1-AP (same clone as 25977-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25977-1-AP (NRAP antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25977-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25977-1-AP (same clone as 25977-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25977-1-AP (NRAP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25977-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 25977-1-AP (same clone as 25977-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25977-1-AP (NRAP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25977-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 25977-1-AP (same clone as 25977-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25977-1-AP (NRAP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25977-1-PBS in a different storage buffer formulation.

NRAP Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25977-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

25977-1-PBS targets NRAP in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23254

  Product name: Recombinant human NRAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1309-1393 aa of BC126407

  Sequence: RHDFVKERGKLIGPQSVRDDPRIQHCRRMGQLQSELQYRRGATSSQAQFHLPMDMVHLVHAKNAQALASDHDYRTQYHKFTALPE

• Full Name: nebulin-related anchoring protein
• Observed Molecular Weight: 190-200 kDa
• GenBank Accession Number: BC126407
• Gene Symbol: NRAP
• Gene ID (NCBI): 4892
• RRID: AB_2918098
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86VF7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NRAP (Nebulin-related-anchoring protein) is a striated muscle-specific protein that is concentrated at intercalated disks in cardiac muscle and at myotendinous junctions in skeletal muscle. NRAP is a 197 kDa multidomain scaffolding protein from nebulin family with many interation partners such as α-actinin, actin, vinculin and filamin (PMID:21276443). During cardiomyocyte development in the foetal heart, NRAP is involved in myofibrillar assembly and links terminal actin filaments to membrane complexes in the adult heart. Several studies observed that NRAP mutation would contributed to the dilated cardiomyopathy which is a highly heterogeneous disease with almost 100 candidates genes to date (PMID:28611399).