NRCAM Monoclonal antibody, PBS Only

NRCAM Monoclonal Antibody for WB, IF-P, Indirect ELISA
Cat No. 68291-1-PBS
Clone No.2E1C3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat, Pig

Applications

WB, IF-P, Indirect ELISA

hBravo, KIAA0343, Neuronal surface protein Bravo, Ng CAM related, Nr CAM, NRCAM

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68291-1-PBS targets NRCAM in WB, IF-P, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.

Tested Reactivity Human, Mouse, Rat, Pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20558

Product name: Recombinant human NRCAM protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 446-628 aa of BC098401

Sequence: EPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDATWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLVVADVSDDDSGTYTCVANTTLDSVSASAVLSVV

Predict reactive species
Full Name neuronal cell adhesion molecule
Calculated Molecular Weight 1304 aa, 144 kDa
Observed Molecular Weight 130-140 kDa
GenBank Accession NumberBC098401
Gene Symbol NRCAM
Gene ID (NCBI) 4897
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92823
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Neuronal cell adhesion molecule (NRCAM) is a member of the L1 subfamily of cell adhesion molecules (CAMs) that belong to the immunoglobulin superfamily (PMID: 11329126). NRCAM is a transmembrane protein composed of six Ig-like domains and five fibronectin type-III repeats in the extracellular region, with a highly conserved cytoplasmic tail. It is mainly expressed in the nervous system and is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM is also expressed outside the nervous system. Altered expression of NRCAM has been associated with tumor progression in diverse organs (PMID: 22182708).

Loading...
||
New chat Able
正在加载,请稍候...