NRG1, isoform Alpha Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of rat brain using 83251-2-RR (same clone as 83251-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using NRG1, isoform Alpha antibody (83251-2-RR, Clone: 240067A6 ) at dilution of 1:500 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83251-2-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 83251-2-RR (same clone as 83251-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using NRG1, isoform Alpha antibody (83251-2-RR, Clone: 240067A6 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83251-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83251-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 83251-2-PBS against Human NRG1, isoform Alpha was performed. The affinity constant is 16.9 nM.

NRG1, isoform Alpha Uni-rAb^® Recombinant Antibody for IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 83251-2-PBS

Clone No.240067A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Synonyms

NRG1, NRG1A, 240067A6, ARIA, GGF

---

Product Information

83251-2-PBS targets NRG1, isoform Alpha in IF/ICC, IF-P, Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35114

  Product name: Recombinant human NRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 177-241 aa of BC007675

  Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK

• Full Name: neuregulin 1
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC007675
• Gene Symbol: NRG1
• Gene ID (NCBI): 3084
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q02297
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Neuregulin 1 (NRG1) is a trophic factor that has been implicated in neural development, neurotransmission, and synaptic plasticity. NRG1 has multiple isoforms that are generated by usage of different promoters and alternative splicing of a single gene. NRG1 and its receptor ErbB tyrosine kinase are expressed not only in the developing nervous system, but also in the adult brain. The immunogen of this antibody is against NRG1 isoform Alpha.