NRG1, isoform Beta1 Polyclonal antibody

NRG1, isoform Beta1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 31147-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, IF/ICC, ELISA

NRG1, isoform Beta1, NRG1, NRG1A, Pro NRG1, Pro-neuregulin-1, membrane-bound isoform, Pro-NRG1, NRG1 isoform SMDF, NRG1, isoform Alpha, NRG1, isoform SMDF, ARIA, GGF, GGF2, Glial growth factor, Heregulin, HGL, HRG, HRG1, HRGA, NDF, Neu differentiation factor, neuregulin 1, Neuregulin 1 isoform SMDF, Neuregulin-1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse brain tissue, rat brain tissue
Positive IHC detected inmouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31147-1-AP targets NRG1, isoform Beta1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag35188

Product name: Recombinant human NRG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 176-246 aa of BC007675

Sequence: TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK

Predict reactive species
Full Name neuregulin 1
Calculated Molecular Weight 70 kDa
Observed Molecular Weight 71 kDa
GenBank Accession NumberBC007675
Gene Symbol NRG1
Gene ID (NCBI) 3084
RRIDAB_3669870
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ02297
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neuregulin 1 (NRG1) is a trophic factor that has been implicated in neural development, neurotransmission, and synaptic plasticity. NRG1 has multiple isoforms that are generated by usage of different promoters and alternative splicing of a single gene. NRG1 and its receptor ErbB tyrosine kinase are expressed not only in the developing nervous system, but also in the adult brain. The immunogen of this antibody is against NRG1 isoform Beta1.

Protocols

Product Specific Protocols
WB protocol for NRG1, isoform Beta1 antibody 31147-1-APDownload protocol
IHC protocol for NRG1, isoform Beta1 antibody 31147-1-APDownload protocol
IF protocol for NRG1, isoform Beta1 antibody 31147-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...