NRG2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NRG2 Polyclonal antibody (33064-1-AP)

• 

  WB analysis using 33064-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33064-1-AP (NRG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

NRG2 Polyclonal Antibody for WB, ELISA

Cat No. 33064-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

neuregulin 2, neuregulin2, Neuregulin-2, NTAK, Pro NRG2

---

Tested Applications

• Positive WB detected in: RT-4 cells, U-251 cells, U-87 MG cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33064-1-AP targets NRG2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39953

  Product name: Recombinant human NRG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 112-404 aa of NM_004883.3

  Sequence: CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQK

• Full Name: neuregulin 2
• Calculated Molecular Weight: 92 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: NM_004883.3
• Gene Symbol: NRG2
• Gene ID (NCBI): 9542
• RRID: AB_3742842
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14511-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NRG2 is a novel member of the neuregulin family of growth and differentiation factors. Through interaction with the ERBB family of receptors, this protein induces the growth and differentiation of epithelial, neuronal, glial, and other types of cells. The gene consists of 12 exons and the genomic structure is similar to that of neuregulin 1, another member of the neuregulin family of ligands. The products of these genes mediate distinct biological processes by acting at different sites in tissues and eliciting different biological responses in cells. This gene is located close to the region for demyelinating Charcot-Marie-Tooth disease locus, but is not responsible for this disease.