NRK1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NRK1 Polyclonal antibody, PBS Only (23805-1-PBS)

• 

  WB analysis using 23805-1-AP (same clone as 23805-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23805-1-AP (NRK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23805-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse kidney using 23805-1-AP (same clone as 23805-1-PBS)

  IP result of anti-NRK1 (IP:23805-1-AP, 4ug; Detection:23805-1-AP 1:3000) with mouse kidney tissue lysate 3400 ug. This data was developed using the same antibody clone with 23805-1-PBS in a different storage buffer formulation.

NRK1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 23805-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

C9orf95, Nicotinamide riboside kinase 1, NMRK1, Ribosylnicotinic acid kinase 1

---

Product Information

23805-1-PBS targets NRK1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20746

  Product name: Recombinant human C9orf95 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-199 aa of BC001366

  Sequence: MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA

• Full Name: chromosome 9 open reading frame 95
• Calculated Molecular Weight: 199 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC001366
• Gene Symbol: C9orf95
• Gene ID (NCBI): 54981
• RRID: AB_3742091
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9NWW6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NRK1 (Nicotinamide riboside kinase 1) is necessary and rate-limiting for the use of exogenous NR and NMN for NAD þ synthesis. Functionally, NRK1 activity restrains CD4+ T cell activation and cytokine production and promotes survival. These activities are linked to increased NRK1 expression in the cytoplasm, where it locally elevates NAD/H levels (PMID: 27725675, 29678570).