NRXN3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NRXN3 Polyclonal antibody, PBS Only (21849-1-PBS)

• 

  WB analysis using 21849-1-AP (same clone as 21849-1-PBS)

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 21849-1-AP (NRXN3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21849-1-PBS in a different storage buffer formulation.

NRXN3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21849-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21849-1-PBS targets NRXN3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16293

  Product name: Recombinant human NRXN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 750-803 aa of BC152457

  Sequence: STTVKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDG

• Full Name: neurexin 3
• Calculated Molecular Weight: 1061 aa, 117 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC152457
• Gene Symbol: NRXN3
• Gene ID (NCBI): 9369
• RRID: AB_2878926
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y4C0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.