NSMCE2 Recombinant monoclonal antibody, PBS Only (Capture)

NSMCE2 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA
Cat No. 85188-4-PBS
Clone No.242862D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA

242862D8, C8orf36, E3 SUMO protein ligase NSE2, E3 SUMO-protein ligase NSE2, E3 SUMO-protein transferase NSE2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85188-4-PBS targets NSMCE2 as part of a matched antibody pair:

MP01897-2: 85188-4-PBS capture and 85188-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4545

Product name: Recombinant human NSMCE2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-247 aa of BC032797

Sequence: MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE

Predict reactive species
Full Name non-SMC element 2, MMS21 homolog (S. cerevisiae)
Calculated Molecular Weight 247 aa, 28 kDa
Observed Molecular Weight28-32 kDa
GenBank Accession NumberBC032797
Gene Symbol NSMCE2
Gene ID (NCBI) 286053
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96MF7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NSMCE2 (E3 SUMO-protein ligase NSE2) has a C-terminal Siz/PIAS-RING (SP-RING) domain with E3 SUMO ligase activity (PMID: 15601841). NSMCE2, an essential SUMO ligase of the SMC5/6 complex suppresses cancer and aging in mice (PMID: 26443207).

Loading...
||
New chat

Able

正在加载,请稍候...