NSMCE2 Recombinant monoclonal antibody

• 

  WB analysis using 85188-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85188-4-RR (NSMCE2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 85188-4-RR

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 85188-4-RR (NSMCE2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 85188-4-RR

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using NSMCE2 antibody (85188-4-RR, Clone: 242862D8 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 85188-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85188-4-RR against Human NSMCE2 were performed. The affinity constant is below 1 pM.

NSMCE2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85188-4-RR

Clone No.242862D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

242862D8, C8orf36, E3 SUMO protein ligase NSE2, E3 SUMO-protein ligase NSE2, E3 SUMO-protein transferase NSE2

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells, A549 cells, U2OS cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85188-4-RR targets NSMCE2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4545

  Product name: Recombinant human NSMCE2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-247 aa of BC032797

  Sequence: MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE

• Full Name: non-SMC element 2, MMS21 homolog (S. cerevisiae)
• Calculated Molecular Weight: 247 aa, 28 kDa
• Observed Molecular Weight: 28-32 kDa
• GenBank Accession Number: BC032797
• Gene Symbol: NSMCE2
• Gene ID (NCBI): 286053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96MF7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NSMCE2 (E3 SUMO-protein ligase NSE2) has a C-terminal Siz/PIAS-RING (SP-RING) domain with E3 SUMO ligase activity (PMID: 15601841). NSMCE2, an essential SUMO ligase of the SMC5/6 complex suppresses cancer and aging in mice (PMID: 26443207).