• Featured Product
  • KD/KO Validated

CD73 Monoclonal antibody

CD73 Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 67789-1-Ig
Clone No.1G5G8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

NT5E, 1G5G8, 5 NT, 5 nucleotidase, 5' nucleotidase, ecto (CD73)

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, A549 cells, HT-29 cells, U-87 MG cells
Positive IHC detected inhuman tonsillitis tissue, mouse kidney tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman appendicitis tissue, human tonsillitis tissue, rat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67789-1-Ig targets CD73 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30616

Product name: Recombinant human NT5E,CD73 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 32-264 aa of BC015940

Sequence: LHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR

Predict reactive species
Full Name 5'-nucleotidase, ecto (CD73)
Calculated Molecular Weight 29 kDa, 63 kDa
Observed Molecular Weight60-70 kDa
GenBank Accession NumberBC015940
Gene Symbol CD73
Gene ID (NCBI) 4907
RRIDAB_2918553
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP21589
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD73, also known as ecto-5'-nucleotidase (5'-NT), is a 70-kDa, glycosyl-phosphatidylinositol-linked membrane-bound glycoprotein found in most tissues (PMID: 18404475; 20179192). CD73 is an ectoenzyme that catalyzes the dephosphorylation of AMP and other nucleoside monophosphates (PMID: 9553767). In the human immune system, CD73 is expressed on subsets of T and B cells, on germinal center follicular dendritic cells, and on thymic medullary reticular fibroblasts and epithelial cells (PMID: 2137649; 9553767). CD73 is highly expressed in many human solid tumors and is closely involved in cancer progression (PMID: 20179192).

Protocols

Product Specific Protocols
IF protocol for CD73 antibody 67789-1-IgDownload protocol
IHC protocol for CD73 antibody 67789-1-IgDownload protocol
WB protocol for CD73 antibody 67789-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...