CD73 Monoclonal antibody

• 

  WB analysis of HepG2 using 67789-1-Ig

  WB result of NT5E/CD73 antibody (67789-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NT5E,CD73 transfected HepG2 cells.

• 

  WB analysis using 67789-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67789-1-Ig (NT5E/CD73 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 67789-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67789-1-Ig (NT5E/CD73 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 67789-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67789-1-Ig (NT5E/CD73 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 67789-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 67789-1-Ig (NT5E/CD73 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 67789-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 67789-1-Ig (NT5E/CD73 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 67789-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 67789-1-Ig (NT5E,CD73 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 67789-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 67789-1-Ig (NT5E,CD73 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human appendicitis using 67789-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human appendicitis tissue using NT5E/CD73 antibody (67789-1-Ig, Clone: 1G5G8 ) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human appendicitis using 67789-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human appendicitis tissue using NT5E/CD73 antibody (67789-1-Ig, Clone: 1G5G8 ) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 67789-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using NT5E/CD73 antibody (67789-1-Ig, Clone: 1G5G8 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of rat liver using 67789-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed rat liver tissue using NT5E/CD73 antibody (67789-1-Ig, Clone: 1G5G8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of rat liver using 67789-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed rat liver tissue using NT5E/CD73 antibody (67789-1-Ig, Clone: 1G5G8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

CD73 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67789-1-Ig

Clone No.1G5G8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

NT5E, 1G5G8, 5 NT, 5 nucleotidase, 5' nucleotidase, ecto (CD73)

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, A549 cells, HT-29 cells, U-87 MG cells
• Positive IHC detected in: human tonsillitis tissue, mouse kidney tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human appendicitis tissue, human tonsillitis tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67789-1-Ig targets CD73 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30616

  Product name: Recombinant human NT5E,CD73 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 32-264 aa of BC015940

  Sequence: LHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR

• Full Name: 5'-nucleotidase, ecto (CD73)
• Calculated Molecular Weight: 29 kDa, 63 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC015940
• Gene Symbol: CD73
• Gene ID (NCBI): 4907
• RRID: AB_2918553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P21589
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD73, also known as ecto-5'-nucleotidase (5'-NT), is a 70-kDa, glycosyl-phosphatidylinositol-linked membrane-bound glycoprotein found in most tissues (PMID: 18404475; 20179192). CD73 is an ectoenzyme that catalyzes the dephosphorylation of AMP and other nucleoside monophosphates (PMID: 9553767). In the human immune system, CD73 is expressed on subsets of T and B cells, on germinal center follicular dendritic cells, and on thymic medullary reticular fibroblasts and epithelial cells (PMID: 2137649; 9553767). CD73 is highly expressed in many human solid tumors and is closely involved in cancer progression (PMID: 20179192).