• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated CD73 Monoclonal antibody

CD73 Monoclonal Antibody for IF-P
Cat No. CL594-67789
Clone No.1G5G8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF-P

NT5E, 5'-NT, 5'-deoxynucleotidase, 5' nucleotidase, ecto (CD73), 5 nucleotidase

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman appendicitis tissue, human tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67789 targets CD73 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30616

Product name: Recombinant human NT5E,CD73 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 32-264 aa of BC015940

Sequence: LHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR

Predict reactive species
Full Name 5'-nucleotidase, ecto (CD73)
Calculated Molecular Weight 29 kDa, 63 kDa
Observed Molecular Weight60-70 kDa
GenBank Accession NumberBC015940
Gene Symbol CD73
Gene ID (NCBI) 4907
RRIDAB_2920183
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP21589
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD73, also known as ecto-5'-nucleotidase (5'-NT), is a 70-kDa, glycosyl-phosphatidylinositol-linked membrane-bound glycoprotein found in most tissues (PMID: 18404475; 20179192). CD73 is an ectoenzyme that catalyzes the dephosphorylation of AMP and other nucleoside monophosphates (PMID: 9553767). In the human immune system, CD73 is expressed on subsets of T and B cells, on germinal center follicular dendritic cells, and on thymic medullary reticular fibroblasts and epithelial cells (PMID: 2137649; 9553767). CD73 is highly expressed in many human solid tumors and is closely involved in cancer progression (PMID: 20179192).

Protocols

Product Specific Protocols
IF protocol for CL594 CD73 antibody CL594-67789Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...