• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated NTF2 Monoclonal antibody

NTF2 Monoclonal Antibody for IF
Cat No. CL488-66063
Clone No.4H7F9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF

NTF 2, NTF2, nuclear transport factor 2, NUTF2, Placental protein 15, PP15

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66063 targets NTF2 in IF applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7879

Product name: Recombinant human NUTF2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 10-127 aa of BC002348

Sequence: IGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG

Predict reactive species
Full Name nuclear transport factor 2
Calculated Molecular Weight 14 kDa
Observed Molecular Weight 13 kDa
GenBank Accession NumberBC002348
Gene Symbol NTF2
Gene ID (NCBI) 10204
RRIDAB_2883246
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP61970
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NUTF2 (nuclear transport factor 2), also named as NTF2, is a cytosolic protein responsible for nuclear import of Ran, a small Ras-like GTPase involved in a number of critical cellular processes, including cell cycle regulation, chromatin organization during mitosis, reformation of the nuclear envelope following mitosis, and controlling the directionality of nucleocytoplasmic transport. Nucleocytoplasmic translocation of NTF2 is regulated in mammalian cells, and may involve a tyrosine and/or threonine kinase-dependent signal transduction mechanism(s) (PMID: 22880006). The MW of this protein is 14 kDa, and this antibody specially recognises the 14 kDa protein.

Loading...
||
New chat Able
正在加载,请稍候...