CoraLite® Plus 488-conjugated NUCB2/nesfatin-1 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-26712

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 NUCB2/nesfatin-1 antibody (CL488-26712) at dilution of 1:200, CL594-phalloidin (red).

• 

  FC experiment of HepG2 using CL488-26712

  1x10^6 HepG2 cells were intracellularly stained with 0.8 ug CoraLite® Plus 488-conjugated NUCB2/nesfatin-1 Polyclonal antibody (CL488-26712)(red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

NUCB2/nesfatin-1 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-26712

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

NUCB2, DNA binding protein NEFA, Gastric cancer antigen Zg4, NEFA, nucleobindin 2

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-26712 targets NUCB2/nesfatin-1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25152

  Product name: Recombinant human NUCB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-106 aa of NM_005013

  Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL

• Full Name: nucleobindin 2
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: NM_005013
• Gene Symbol: NUCB2
• Gene ID (NCBI): 4925
• RRID: AB_3672802
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P80303
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

NucB2, an anorexigenic molecule, is expressed mainly in the hypothalamus, particularly in the supraoptic nucleus (SON) and the paraventricular nucleus (PVN). NucB2 is also expressed in the subfornical organ (SFO). Because the SON and PVN are involved in body fluid regulation, NucB2 may be involved in dehydration-induced anorexia. NUCB2 is composed of a signal peptide of 24 amino acids in the N-terminal region and a protin structure containing 396 amino acids. Nesfatin-1 is an 82-amino-acid peptide hormone cleaved from nucleobindin2 (NUCB2).