Tested Applications
| Positive WB detected in | mouse brain tissue, HEK-293T cells, HepG2 cells, human milk, mouse spleen tissue, mouse testis tissue, rat brain tissue |
| Positive IHC detected in | human colon cancer tissue, human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IF | See 1 publications below |
Product Information
26712-1-AP targets NUCB2/nesfatin-1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25152 Product name: Recombinant human NUCB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-106 aa of NM_005013 Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL Predict reactive species |
| Full Name | nucleobindin 2 |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 40-50 kDa |
| GenBank Accession Number | NM_005013 |
| Gene Symbol | NUCB2 |
| Gene ID (NCBI) | 4925 |
| RRID | AB_2880610 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P80303 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NucB2, an anorexigenic molecule, is expressed mainly in the hypothalamus, particularly in the supraoptic nucleus (SON) and the paraventricular nucleus (PVN). NucB2 is also expressed in the subfornical organ (SFO). Because the SON and PVN are involved in body fluid regulation, NucB2 may be involved in dehydration-induced anorexia. NUCB2 is composed of a signal peptide of 24 amino acids in the N-terminal region and a protin structure containing 396 amino acids. Nesfatin-1 is an 82-amino-acid peptide hormone cleaved from nucleobindin2 (NUCB2).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NUCB2/nesfatin-1 antibody 26712-1-AP | Download protocol |
| IF protocol for NUCB2/nesfatin-1 antibody 26712-1-AP | Download protocol |
| IHC protocol for NUCB2/nesfatin-1 antibody 26712-1-AP | Download protocol |
| WB protocol for NUCB2/nesfatin-1 antibody 26712-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Commun Signal Nesfatin-1 enhances vascular smooth muscle calcification through facilitating BMP-2 osteogenic signaling
| ||
Neurogastroenterol Motil Frequency-Dependent Effects of Transauricular Vagus Nerve Stimulation on Alleviating Visceral Hypersensitivity: Involvement of the Nesfatin-1/CRF/CRF1R Pathway. | ||
J Ethnopharmacol Multi-platform analysis reveals the material basis and therapeutic mechanism of Chen Xiang Qu decoction piece in ameliorating functional dyspepsia in rats. | ||
J Transl Med NUCB2/Nesfatin-1 drives breast cancer metastasis through the up-regulation of cholesterol synthesis via the mTORC1 pathway |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Guorong (Verified Customer) (11-22-2022) | Clear and specific band
|



















