Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-83917-5 targets NUCB2/nesfatin-1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25152 Product name: Recombinant human NUCB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-106 aa of NM_005013 Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL Predict reactive species |
| Full Name | nucleobindin 2 |
| Calculated Molecular Weight | 50 kDa |
| GenBank Accession Number | NM_005013 |
| Gene Symbol | NUCB2 |
| Gene ID (NCBI) | 4925 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P80303 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NucB2, an anorexigenic molecule, is expressed mainly in the hypothalamus, particularly in the supraoptic nucleus (SON) and the paraventricular nucleus (PVN). NucB2 is also expressed in the subfornical organ (SFO). Because the SON and PVN are involved in body fluid regulation, NucB2 may be involved in dehydration-induced anorexia. NUCB2 is composed of a signal peptide of 24 amino acids in the N-terminal region and a protin structure containing 396 amino acids. Nesfatin-1 is an 82-amino-acid peptide hormone cleaved from nucleobindin2 (NUCB2).
