NUDT13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NUDT13 Polyclonal antibody, PBS Only (25912-1-PBS)

• 

  WB analysis using 25912-1-AP (same clone as 25912-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25912-1-AP (NUDT13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25912-1-PBS in a different storage buffer formulation.

NUDT13 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25912-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25912-1-PBS targets NUDT13 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23186

  Product name: Recombinant human NUDT13 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-263 aa of BC046173

  Sequence: MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFYLFHSLAPLLQTSAHQYLAPRHSLLELERLLGKFGQDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISASLHKPEMETELKGSFIELRKALFQLNARDASLLSTAQALLRWHDAHQFCSRSGQPTKKNVAGSKRVCPSNNIIYYPQIQVNLRELETAAWFSHDEVATALKRKGPYTQQQNGTFPFWLPPKLAISHQLIKEWVEKQTCSSLPA

• Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 13
• Calculated Molecular Weight: 352 aa, 40 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: BC046173
• Gene Symbol: NUDT13
• Gene ID (NCBI): 25961
• RRID: AB_2918097
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86X67
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.