NUDT3/4/10/11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NUDT3/4/10/11 Polyclonal antibody, PBS Only (10912-1-PBS)

• 

  WB analysis using 10912-1-AP (same clone as 10912-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10912-1-AP (NUDT11 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10912-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 10912-1-AP (same clone as 10912-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10912-1-AP (NUDT11 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10912-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 10912-1-AP (same clone as 10912-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 10912-1-AP (NUDT11 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10912-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10912-1-AP (same clone as 10912-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10912-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10912-1-AP (same clone as 10912-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10912-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 10912-1-AP (same clone as 10912-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10912-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 10912-1-AP (same clone as 10912-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10912-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10912-1-AP (same clone as 10912-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10912-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10912-1-AP (same clone as 10912-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10912-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10912-1-PBS in a different storage buffer formulation.

NUDT3/4/10/11 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10912-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10912-1-PBS targets NUDT3/4/10/11 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1346

  Product name: Recombinant human NUDT11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of BC009942

  Sequence: MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP

• Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 11
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC009942
• Gene Symbol: NUDT11
• Gene ID (NCBI): 55190
• RRID: AB_2153836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96G61
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NUDT11 (nucleoside diphosphate linked moiety X-type motif 11), also named as DIPP3B or APS1, belongs to the subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (PMID: 12105228, 12689335). Five human isoforms of DIPP have been found and named as DIPP type 1(NUDT3), type 2α/β(NUDT4), type 3α(NUDT10) and type 3β(NUDT11), which have the similar molecular weight and high homology (PMID: 12105228). This antibody can recognize all the 5 isoforms of DIPP (NUDT3/4/10/11).