NUDT3/4/10/11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NUDT3/4/10/11 Polyclonal antibody, PBS Only (20542-1-PBS)

• 

  WB analysis using 20542-1-AP (same clone as 20542-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20542-1-AP (NUDT3/4/10/11 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20542-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 20542-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20542-1-AP (NUDT3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

NUDT3/4/10/11 Polyclonal Antibody for WB, ELISA

Cat No. 20542-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

---

Product Information

20542-1-PBS targets NUDT3/4/10/11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14587

  Product name: Recombinant human NUDT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC007727

  Sequence: MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR

• Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 3
• Calculated Molecular Weight: 172 aa, 19 kDa
• Observed Molecular Weight: 20-30 kDa
• GenBank Accession Number: BC007727
• Gene Symbol: NUDT3
• Gene ID (NCBI): 11165
• RRID: AB_10696178
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95989
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NUDT3 (nucleoside diphosphate linked moiety X-type motif 3), also named as DIPP1, belongs to the subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (PMID: 12105228, 12689335). Five human isoforms of DIPP have been found and named as DIPP type 1(NUDT3), type 2α/β(NUDT4), type 3α(NUDT10) and type 3β(NUDT11), which have the similar molecular weight and high homology (PMID: 12105228). This antibody can recognize all the 5 isoforms of DIPP (NUDT3/4/10/11).