NUFIP2 Monoclonal antibody

• 

  WB analysis using 67195-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67195-1-Ig (NUFIP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 67195-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67195-1-Ig (NUFIP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 67195-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67195-1-Ig (NUFIP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of 4T1 using 67195-1-Ig

  4T1 cells were subjected to SDS PAGE followed by western blot with 67195-1-Ig (NUFIP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 67195-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67195-1-Ig (NUFIP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 67195-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67195-1-Ig (NUFIP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 67195-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67195-1-Ig (NUFIP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 67195-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67195-1-Ig (NUFIP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 67195-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using NUFIP2 antibody (67195-1-Ig, Clone: 2A4E3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1).

NUFIP2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67195-1-Ig

Clone No.2A4E3

Publications(1)

Reviews (1)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Cell proliferation-inducing gene 1 protein, 82-FIP, 82 kDa FMRP-interacting protein, 82 FIP, 2A4E3

---

Tested Applications

• Positive WB detected in: HeLa cells, 4T1 cells, HSC-T6 cells, NIH/3T3 cells, HEK-293 cells, MCF-7 cells, Jurkat cells
• Positive IHC detected in: mouse cerebellum tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

67195-1-Ig targets NUFIP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29040

  Product name: Recombinant human NUFIP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 357-695 aa of BC108307

  Sequence: SYASKVKENLNKTIQNSSVSPTSSSSSSSSTGETQTQSSSRLSQVPMSALKSVTSANFSNGPVLAGTDGNVYPPGGQPLLTTAANTLTPISSGTDSVLQDMSLTSAAVEQIKTSLFIYPSNMQTMLLSTAQVDLPSQTDQQNLGDIFQNQWGLSFINEPSAGPETVTGKSSEHKVMEVTFQGEYPATLVSQGAEIIPSGTEHPVFPKAYELEKRTSPQVLGSILKSGTTSESGALSLEPSHIGDLQKADTSSQGALVFLSKDYEIESQNPLASPTNTLLGSAKEQRYQRGLERNDSWGSFDLRAAIVYHTKEMESIWNLQKQDPKRIITYNEAMDSPDQ

• Full Name: nuclear fragile X mental retardation protein interacting protein 2
• Calculated Molecular Weight: 695 aa, 76 kDa
• Observed Molecular Weight: 76 kDa, 82 kDa
• GenBank Accession Number: BC108307
• Gene Symbol: NUFIP2
• Gene ID (NCBI): 57532
• RRID: AB_2882489
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q7Z417
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Neurobiol Dis; ATXN2L primarily interacts with NUFIP2, the absence of ATXN2L results in NUFIP2 depletion, and the ATXN2-polyQ expansion triggers NUFIP2 accumulation; Authors - Jana Key

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Sun (Verified Customer) (01-05-2023)

An excellent antibody with great sensitivity and specificity.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: HEK293T