NUFIP2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67195-1-Ig (same clone as 67195-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67195-1-Ig (NUFIP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67195-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67195-1-Ig (same clone as 67195-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67195-1-Ig (NUFIP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67195-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67195-1-Ig (same clone as 67195-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67195-1-Ig (NUFIP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67195-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67195-1-Ig (same clone as 67195-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67195-1-Ig (NUFIP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67195-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 67195-1-Ig (same clone as 67195-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67195-1-Ig (NUFIP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67195-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 67195-1-Ig (same clone as 67195-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67195-1-Ig (NUFIP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67195-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67195-1-Ig (same clone as 67195-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67195-1-Ig (NUFIP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67195-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67195-1-Ig (same clone as 67195-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67195-1-Ig (NUFIP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67195-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67195-1-Ig (same clone as 67195-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using NUFIP2 antibody (67195-1-Ig, Clone: 2A4E3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67195-1-PBS in a different storage buffer formulation.

NUFIP2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67195-1-PBS

Clone No.2A4E3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Cell proliferation-inducing gene 1 protein, 82-FIP, 82 kDa FMRP-interacting protein, 82 FIP, 2A4E3

---

Product Information

67195-1-PBS targets NUFIP2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29040

  Product name: Recombinant human NUFIP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 357-695 aa of BC108307

  Sequence: SYASKVKENLNKTIQNSSVSPTSSSSSSSSTGETQTQSSSRLSQVPMSALKSVTSANFSNGPVLAGTDGNVYPPGGQPLLTTAANTLTPISSGTDSVLQDMSLTSAAVEQIKTSLFIYPSNMQTMLLSTAQVDLPSQTDQQNLGDIFQNQWGLSFINEPSAGPETVTGKSSEHKVMEVTFQGEYPATLVSQGAEIIPSGTEHPVFPKAYELEKRTSPQVLGSILKSGTTSESGALSLEPSHIGDLQKADTSSQGALVFLSKDYEIESQNPLASPTNTLLGSAKEQRYQRGLERNDSWGSFDLRAAIVYHTKEMESIWNLQKQDPKRIITYNEAMDSPDQ

• Full Name: nuclear fragile X mental retardation protein interacting protein 2
• Calculated Molecular Weight: 695 aa, 76 kDa
• Observed Molecular Weight: 76 kDa, 82 kDa
• GenBank Accession Number: BC108307
• Gene Symbol: NUFIP2
• Gene ID (NCBI): 57532
• RRID: AB_2882489
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q7Z417
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.