• Featured Product
  • KD/KO Validated

NUP155 Monoclonal antibody, PBS Only

NUP155 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66359-1-PBS
Clone No.1A7F2

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

155 kDa nucleoporin, KIAA0791, N155, nucleoporin 155kDa, Nucleoporin Nup155, NUP155

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66359-1-PBS targets NUP155 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3638

Product name: Recombinant human NUP155 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1043-1391 aa of BC039257

Sequence: LIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH

Predict reactive species
Full Name nucleoporin 155kDa
Calculated Molecular Weight 1391 aa, 155 kDa
Observed Molecular Weight 140-155 kDa
GenBank Accession NumberBC039257
Gene Symbol NUP155
Gene ID (NCBI) 9631
RRIDAB_2881738
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75694
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NUP155 is a nucleoporin, the major component of the nuclear pore complex (NPC) that is essential for nuclear envelope biogenesis. Mutation of NUP155 has been linked to cardiovascular disease.

Loading...
||
New chat Able
正在加载,请稍候...