NUP155 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK293 cells using 66359-1-Ig (same clone as 66359-1-PBS)

  WB result of NUP155 antibody (66359-1-Ig, 1: 6000) with si-Control and si-NUP155 transfected HEK293 cells. This data was developed using the same antibody clone with 66359-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66359-1-Ig (same clone as 66359-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66359-1-Ig (NUP155 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66359-1-PBS in a different storage buffer formulation.

• 

  WB analysis of ROS1728 using 66359-1-Ig (same clone as 66359-1-PBS)

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 66359-1-Ig (NUP155 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66359-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66359-1-Ig (same clone as 66359-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66359-1-Ig (NUP155 Antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66359-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66359-1-Ig (same clone as 66359-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66359-1-Ig (NUP155 Antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66359-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NUP155 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66359-1-PBS

Clone No.1A7F2

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

155 kDa nucleoporin, KIAA0791, N155, nucleoporin 155kDa, Nucleoporin Nup155, NUP155

---

Product Information

66359-1-PBS targets NUP155 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3638

  Product name: Recombinant human NUP155 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1043-1391 aa of BC039257

  Sequence: LIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH

• Full Name: nucleoporin 155kDa
• Calculated Molecular Weight: 1391 aa, 155 kDa
• Observed Molecular Weight: 140-155 kDa
• GenBank Accession Number: BC039257
• Gene Symbol: NUP155
• Gene ID (NCBI): 9631
• RRID: AB_2881738
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75694
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NUP155 is a nucleoporin, the major component of the nuclear pore complex (NPC) that is essential for nuclear envelope biogenesis. Mutation of NUP155 has been linked to cardiovascular disease.