NUP155 Monoclonal antibody

• 

  WB analysis of HEK293 cells using 66359-1-Ig

  WB result of NUP155 antibody (66359-1-Ig, 1: 6000) with si-Control and si-NUP155 transfected HEK293 cells.

• 

  WB analysis of HeLa using 66359-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66359-1-Ig (NUP155 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of ROS1728 using 66359-1-Ig

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 66359-1-Ig (NUP155 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 66359-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66359-1-Ig (NUP155 Antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66359-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66359-1-Ig (NUP155 Antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

NUP155 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66359-1-Ig

Clone No.1A7F2

Publications(4)

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

155 kDa nucleoporin, KIAA0791, N155, nucleoporin 155kDa, Nucleoporin Nup155, NUP155

---

Tested Applications

• Positive WB detected in: HEK293 cells, HeLa cells, ROS1728 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below

Product Information

66359-1-Ig targets NUP155 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3638

  Product name: Recombinant human NUP155 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1043-1391 aa of BC039257

  Sequence: LIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH

• Full Name: nucleoporin 155kDa
• Calculated Molecular Weight: 1391 aa, 155 kDa
• Observed Molecular Weight: 140-155 kDa
• GenBank Accession Number: BC039257
• Gene Symbol: NUP155
• Gene ID (NCBI): 9631
• RRID: AB_2881738
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75694
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NUP155 is a nucleoporin, the major component of the nuclear pore complex (NPC) that is essential for nuclear envelope biogenesis. Mutation of NUP155 has been linked to cardiovascular disease.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Neuron; Nucleoporin Seh1 Interacts with Olig2/Brd7 to Promote Oligodendrocyte Differentiation and Myelination.; Authors - Zhixiong Liu
rat	WB	J Ethnopharmacol; Xinfuli granule alleviates metabolic remodeling through inhibition of endoplasmic reticulum stress and mitochondrial injury in heart failure; Authors - Yan-Ni Su
human	WB	BMC Cancer; Pan-cancer analysis of NUP155 and validation of its role in breast cancer cell proliferation, migration, and apoptosis; Authors - Zi-Qiong Wang ; KD Validated
human	WB	Front Pharmacol; NUP155 and NDC1 interaction in NSCLC: a promising target for tumor progression; Authors - Kai-Min Li