NUP160 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NUP160 Polyclonal antibody, PBS Only (16084-1-PBS)

• 

  WB analysis of HeLa using 16084-1-AP (same clone as 16084-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16084-1-AP (NUP160 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16084-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 16084-1-AP (same clone as 16084-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 16084-1-AP (NUP160 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16084-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 16084-1-AP (same clone as 16084-1-PBS)

  IP result of anti-NUP160 (IP:16084-1-AP, 4ug; Detection:16084-1-AP 1:500) with HeLa cells lysate 4000ug. This data was developed using the same antibody clone with 16084-1-PBS in a different storage buffer formulation.

NUP160 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 16084-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

16084-1-PBS targets NUP160 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9083

  Product name: Recombinant human NUP160 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-190 aa of BC009822

  Sequence: MAAAGALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSVSWLSAISFISQITLGVTNVVLERCLLELKEIWILVIPHQAYFDSYRLK

• Full Name: nucleoporin 160kDa
• Calculated Molecular Weight: 1316 aa, 149 kDa
• Observed Molecular Weight: 149 kDa
• GenBank Accession Number: BC009822
• Gene Symbol: NUP160
• Gene ID (NCBI): 23279
• RRID: AB_2157341
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12769
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.