NUP62CL Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NUP62CL Polyclonal antibody, PBS Only (25381-1-PBS)

• 

  WB analysis of HeLa using 25381-1-AP (same clone as 25381-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 25381-1-AP (NUP62CL Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25381-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 25381-1-AP (same clone as 25381-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25381-1-AP (NUP62CL Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25381-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 25381-1-AP (same clone as 25381-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 25381-1-AP (NUP62CL Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25381-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 25381-1-AP (same clone as 25381-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 25381-1-AP (NUP62CL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25381-1-PBS in a different storage buffer formulation.

NUP62CL Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25381-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

25381-1-PBS targets NUP62CL in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21107

  Product name: Recombinant human NUP62CL protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-72 aa of BC017799

  Sequence: MQFTSISNSLTSTAAIGLSFTTSTTTTATFTTNTTTTITSGFTVNQNQLLSRGFENLVPYTSTVRFVFYMEK

• Full Name: nucleoporin 62kDa C-terminal like
• Calculated Molecular Weight: 72 aa, 8 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC017799
• Gene Symbol: NUP62CL
• Gene ID (NCBI): 54830
• RRID: AB_2880051
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1M0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.