NUP98-NUP96 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NUP98-NUP96 Polyclonal antibody, PBS Only (12329-1-PBS)

• 

  WB analysis using 12329-1-AP (same clone as 12329-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12329-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 12329-1-AP (same clone as 12329-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12329-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12329-1-AP (same clone as 12329-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12329-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 12329-1-AP (same clone as 12329-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12329-1-PBS in a different storage buffer formulation.

• 

  IP experiment of COLO 320 using 12329-1-AP (same clone as 12329-1-PBS)

  IP result of anti-NUP98-NUP96 (IP:12329-1-AP, 4ug; Detection:12329-1-AP 1:1000) with COLO 320 cells lysate 2000ug. This data was developed using the same antibody clone with 12329-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12329-1-AP (same clone as 12329-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12329-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12329-1-AP (same clone as 12329-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12329-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12329-1-AP (same clone as 12329-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12329-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12329-1-AP (same clone as 12329-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12329-1-AP (NUP98-NUP96 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12329-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 12329-1-AP (same clone as 12329-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using NUP98-NUP96 antibody (12329-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12329-1-PBS in a different storage buffer formulation.

NUP98-NUP96 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12329-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

12329-1-PBS targets NUP98-NUP96 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3016

  Product name: Recombinant human NUP98-NUP96 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1515-1817 aa of BC012906

  Sequence: TADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL

• Full Name: nucleoporin 98kDa
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC012906
• Gene Symbol: NUP98
• Gene ID (NCBI): 4928
• RRID: AB_10973678
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52948
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Nup98-Nup96 (also known as Nup196, ADIR2 or ADAR2), encoded by NUP98 gene, is a component of the nuclear pore complex (NPC) . It is first synthesized as 186-198 kDa Nup98-Nup96 precursors and the precursors shortly undergo autoproteolysis to give rise to two nucleoporins, the amino-terminal Nup98 (Nup98-N) and carboxy-terminal Nup96 (Nup96-C). Both of Nup98 and Nup96 are localized to the nucleoplasmic side of the NPC. This antibody was raised against the carboxy-terminal region of Nup98-Nup96, it recognizes all Nup98-Nup96 proteins except Nup98-N. Since the autoproteolysis is very rapid this antibody usually detected 98-115 kDa Nup96 protein in multiple cell lines. It is notable that RNA-editing deaminase 1 (Gene ID: 104), also named ADAR2, is a different protein from Nup98-Nup96 (ADAR2).