NXT1 Monoclonal antibody

• 

  WB analysis using 67680-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67680-1-Ig (NXT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis using 67680-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67680-1-Ig (NXT1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 67680-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NXT1 antibody (67680-1-Ig, Clone: 2C10A2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

NXT1 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67680-1-Ig

Clone No.2C10A2

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

MTR2, NTF2 like export factor 1, NTF2 related export protein 1, NXT1, P15, Protein p15

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67680-1-Ig targets NXT1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30039

  Product name: Recombinant human NXT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-140 aa of BC000759

  Sequence: MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS

• Full Name: NTF2-like export factor 1
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC000759
• Gene Symbol: NXT1
• Gene ID (NCBI): 29107
• RRID: AB_2882873
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UKK6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NXT1 is located in the nuclear envelope and is homologous to nuclear transport factor 2. NXT1 functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. NXT1 also heterodimerizes with Tap protein and regulates the ability of Tap protein to mediate nuclear mRNA export.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	iScience; Multi-omics approach reveals posttranscriptionally regulated genes are essential for human pluripotent stem cells.; Authors - Mio Iwasaki