NXT1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67680-1-Ig (same clone as 67680-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67680-1-Ig (NXT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67680-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67680-1-Ig (same clone as 67680-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67680-1-Ig (NXT1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67680-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67680-1-Ig (same clone as 67680-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NXT1 antibody (67680-1-Ig, Clone: 2C10A2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67680-1-PBS in a different storage buffer formulation.

NXT1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67680-1-PBS

Clone No.2C10A2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

MTR2, NTF2 like export factor 1, NTF2 related export protein 1, NXT1, P15, Protein p15

---

Product Information

67680-1-PBS targets NXT1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30039

  Product name: Recombinant human NXT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-140 aa of BC000759

  Sequence: MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS

• Full Name: NTF2-like export factor 1
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC000759
• Gene Symbol: NXT1
• Gene ID (NCBI): 29107
• RRID: AB_2882873
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UKK6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NXT1 is located in the nuclear envelope and is homologous to nuclear transport factor 2. NXT1 functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. NXT1 also heterodimerizes with Tap protein and regulates the ability of Tap protein to mediate nuclear mRNA export.